PDB entry 4rh4

View 4rh4 on RCSB PDB site
Description: Zinc-substituted pseudoazurin solved by S/Zn-SAD phasing
Class: metal binding protein
Keywords: sad, beta-sandwich, divalent metal-ion, metalloprotein, metal binding protein
Deposited on 2014-10-01, released 2015-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.185
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4rh4a_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rh4A (A:)
    enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
    nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
    sak