PDB entry 4rfp

View 4rfp on RCSB PDB site
Description: Crystal structure of a acidic PLA2 from Trimeresurus stejnegeri venom
Class: hydrolase
Keywords: alpha-helix, HYDROLASE, glycerophospholipid, venom gland
Deposited on 2014-09-26, released 2014-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acidic phospholipase A2 5
  Species: Trimeresurus stejnegeri [TaxId:39682]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82896 (0-120)
    • conflict (54-55)
    • conflict (60)
    • conflict (113)
  Domains in SCOPe 2.08: d4rfpa_
• Chain 'B':
  Compound: Acidic phospholipase A2 5
  Species: Trimeresurus stejnegeri [TaxId:39682]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82896 (0-120)
    • conflict (54-55)
    • conflict (60)
    • conflict (113)
  Domains in SCOPe 2.08: d4rfpb_
• Heterogens: PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4rfpA (A:)
  nlmqfellimkvagrsgivwysdygcfcgkgghgrpqdatdrccfvhdccygkvngcdpk
  edfyryssnngdivceannpctkeicecdkaaaicfrdnkdtydnkywnipmescqesep
  c
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4rfpB (B:)
  nlmqfellimkvagrsgivwysdygcfcgkgghgrpqdatdrccfvhdccygkvngcdpk
  edfyryssnngdivceannpctkeicecdkaaaicfrdnkdtydnkywnipmescqesep
  c