PDB entry 4rez

View 4rez on RCSB PDB site
Description: Crystal structure of the Middle-East respiratory syndrome coronavirus papain-like protease
Class: viral protein
Keywords: zinc ribbon, deubiquitinase, papain-like protease, VIRAL PROTEIN
Deposited on 2014-09-24, released 2014-10-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ORF1ab protein
    Species: Human betacoronavirus 2c Jordan-N3/2012 [TaxId:1306931]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4reza1, d4reza2
  • Heterogens: ZN, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rezA (A:)
    tqqltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslylad
    nltadetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavim
    tldllkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakae
    lccsarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlve
    httpwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvs
    ktsdwkckvtdvlfpgqkyssdcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rezA (A:)
    tievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlta
    detkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtldl
    lkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelccs
    armvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehttp
    wlllsgtpneklvttapdfvafnvfqgghyvharlklilkfdsgtvsktsdwkckvtdvl
    fpgqkyssdcn