PDB entry 4re2

View 4re2 on RCSB PDB site
Description: Different transition state conformations for the hydrolysis of beta-mannosides and beta-glucosides in the rice Os7BGlu26 family GH1 beta-mannosidase/beta-glucosidase
Class: Hydrolase
Keywords: GH1, Hydrolase
Deposited on 2014-09-21, released 2015-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-mannosidase/beta-glucosidase
    Species: Oryza sativa Indica Group [TaxId:39946]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5ABY0 (20-End)
      • expression tag (16-19)
    Domains in SCOPe 2.06: d4re2a1, d4re2a2
  • Heterogens: MVL, TRS, EPE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4re2A (A:)
    amaditslykkagsaaapftywlnpeiydagglsrrafpegfvfgtaasayqvegmakqg
    grgpsiwdafiekpgtipnnatadvtvdeyhrykedvnimknmgfdayrfsiswsrifpn
    gtgmvnqegvdyynrlidymvkkgikpyanlyhydlplalheqylgwlspniveafadya
    dfcfqtfgdrvkdwftfneprcvaalgydngfhapgrcsgcdaggnsttepylaahhlil
    shaaavkryrekyqlyqkgrigilldfvwyepfsdsnadraaaqrardfhlgwfldpiih
    grypysmleivkdrmptfsdeesrmvkdsidyvginhytsfymkdpgpwnltptsyqddw
    hvgfayerngvpigaqansywlyivpwginkavtyvketygnptmilsengmdqpgnvsi
    tqgvhdtvriryyrnyitelkkaiddgakvigyfawslldnfewrlgytsrfgivyvdyk
    tlkrypkdsafwfknmlsskkrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4re2A (A:)
    apftywlnpeiydagglsrrafpegfvfgtaasayqvegmakqggrgpsiwdafiekpgt
    ipnnatadvtvdeyhrykedvnimknmgfdayrfsiswsrifpngtgmvnqegvdyynrl
    idymvkkgikpyanlyhydlplalheqylgwlspniveafadyadfcfqtfgdrvkdwft
    fneprcvaalgydngfhapgrcsgcdaggnsttepylaahhlilshaaavkryrekyqly
    qkgrigilldfvwyepfsdsnadraaaqrardfhlgwfldpiihgrypysmleivkdrmp
    tfsdeesrmvkdsidyvginhytsfymkdpgpwnltptsyqddwhvgfayerngvpigaq
    ansywlyivpwginkavtyvketygnptmilsengmdqpgnvsitqgvhdtvriryyrny
    itelkkaiddgakvigyfawslldnfewrlgytsrfgivyvdyktlkrypkdsafwfknm
    ls