PDB entry 4rd2

View 4rd2 on RCSB PDB site
Description: Structure of aIF2 gamma variant bound to GDPNP
Class: translation
Keywords: Rossmann-fold, TRANSLATION
Deposited on 2014-09-18, released 2015-05-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: eif2g, SSO0412, sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q980A5 (Start-414)
      • engineered mutation (96)
    Domains in SCOPe 2.05: d4rd2a1, d4rd2a2, d4rd2a3
  • Heterogens: GNP, MG, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rd2A (A:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapgaevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rd2A (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapgaevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei