PDB entry 4rcr

View 4rcr on RCSB PDB site
Description: structure of the reaction center from rhodobacter sphaeroides r-26 and 2.4.1: protein-cofactor (bacteriochlorophyll, bacteriopheophytin, and carotenoid) interactions
Deposited on 1991-09-09, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rcrH (H:)
    laslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgrg
    tltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnki
    kpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrll
    pmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rcrL (L:)
    ferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwnpqli
    svyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfafafa
    ilayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisffftna
    lalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsavffs
    alcmiitgtiwfdqwvdwwqwwvklp
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rcrM (M:)
    ifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsglm
    wfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfva
    vwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshldw
    tnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgtaa
    eraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh