PDB entry 4rb3

View 4rb3 on RCSB PDB site
Description: Crystal structure of Magnetospirillum gryphiswaldense MSR-1 Fur-Mn2+-feoAB1 operator
Class: metal binding protein/DNA
Keywords: ferric uptake regulator (FUR), metal ion activation, operator recognition, cooperativity, broad substrate recognition, DNA shape readout, METAL BINDING PROTEIN-DNA complex
Deposited on 2014-09-12, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (25-mer)
  • Chain 'B':
    Compound: DNA (25-mer)
  • Chain 'C':
    Compound: DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)
    Species: Magnetospirillum gryphiswaldense [TaxId:1430440]
    Gene: Fur, MGMSRv2_3137
    Database cross-references and differences (RAF-indexed):
    • Uniprot V6F4Q0 (2-End)
      • engineered mutation (10)
      • engineered mutation (15)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4rb3c_
  • Chain 'D':
    Compound: DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)
    Species: Magnetospirillum gryphiswaldense [TaxId:1430440]
    Gene: Fur, MGMSRv2_3137
    Database cross-references and differences (RAF-indexed):
    • Uniprot V6F4Q0
      • engineered mutation (10)
      • engineered mutation (15)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4rb3d_
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rb3C (C:)
    ghmvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrt
    vrlfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkh
    gfrlvghrlelygvpltsggdsddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rb3C (C:)
    mvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvr
    lfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgf
    rlvghrlelygvplts
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4rb3D (D:)
    ghmvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrt
    vrlfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkh
    gfrlvghrlelygvpltsggdsddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rb3D (D:)
    vsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvrl
    feeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgfr
    lvghrlelygvpl