PDB entry 4rb1

View 4rb1 on RCSB PDB site
Description: Crystal structure of Magnetospirillum gryphiswaldense MSR-1 Fur-Mn2+-E. coli Fur box
Class: metal binding protein/DNA
Keywords: ferric uptake regulator (FUR), metal ion activation, operator recognition, cooperativity, broad substrate recognition, DNA shape readout, METAL BINDING PROTEIN-DNA complex
Deposited on 2014-09-12, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)
    Species: Magnetospirillum gryphiswaldense [TaxId:1430440]
    Gene: Fur, MGMSRv2_3137
    Database cross-references and differences (RAF-indexed):
    • Uniprot V6F4Q0
      • engineered mutation (10)
      • engineered mutation (15)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4rb1a_
  • Chain 'B':
    Compound: DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)
    Species: Magnetospirillum gryphiswaldense [TaxId:1430440]
    Gene: Fur, MGMSRv2_3137
    Database cross-references and differences (RAF-indexed):
    • Uniprot V6F4Q0 (2-End)
      • expression tag (1)
      • engineered mutation (10)
      • engineered mutation (15)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4rb1b1, d4rb1b2
  • Chain 'D':
    Compound: DNA (5'-d(*cp*gp*cp*gp*ap*tp*ap*ap*tp*gp*ap*tp*ap*ap*tp*cp*ap*tp*tp*ap*tp*cp*cp*gp*c)-3')
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rb1A (A:)
    ghmvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrt
    vrlfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkh
    gfrlvghrlelygvpltsggdsddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rb1A (A:)
    vsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvrl
    feeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgfr
    lvghrlelygvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rb1B (B:)
    ghmvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrt
    vrlfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkh
    gfrlvghrlelygvpltsggdsddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rb1B (B:)
    hmvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdpisiatvyrtvr
    lfeeesilerhdfgdgraryeeapsehhdhlidvnarvieftspeiealqreiarkhgfr
    lvghrlelygvp
    

  • Chain 'D':
    No sequence available.