PDB entry 4ra2

View 4ra2 on RCSB PDB site
Description: PP2Ca
Class: metal binding protein
Keywords: serine/threonine phosphatase, PP2C family, Phosphorylation, METAL BINDING PROTEIN
Deposited on 2014-09-09, released 2015-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein phosphatase 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPM1A, PPPM1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ra2a1, d4ra2a2
  • Heterogens: MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ra2A (A:)
    gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg
    hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
    adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
    vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
    wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapkvspea
    vkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrnvieav
    ynrlnpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ra2A (A:)
    gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg
    hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
    adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
    vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
    wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapkvspea
    vkkeaeldkylecrveeiikgvpdlvhvmrtlasenipslppggelaskrnvieavynrl
    npy