PDB entry 4r97

View 4r97 on RCSB PDB site
Description: Crystal structure of the Fab fragment of KKO
Class: immune system
Keywords: immunoglobulin, immune system
Deposited on 2014-09-03, released 2015-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Platelet factor 4 antibody KKO light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R97 (0-213)
    Domains in SCOPe 2.06: d4r97b1, d4r97b2
  • Chain 'C':
    Compound: Platelet factor 4 antibody KKO heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R97 (0-217)
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4r97B (B:)
diqmiqsqkfmstsvgdrvtvtckasqnvgtnvawyqqkpgqspnaliysasyrysgvpd
rftgsgsgtdftltitnvqsedladyfcqqynsypltfgtgtkldlkradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrnec

  • Chain 'C':
    No sequence available.