PDB entry 4r4s

View 4r4s on RCSB PDB site
Description: Crystal structure of chimeric beta-lactamase cTEM-19m at 1.1 angstrom resolution
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2014-08-19, released 2015-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM,Beta-lactamase PSE-4
    Species: Escherichia coli, Pseudomonas aeruginosa [TaxId:562, 287]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6, pse4, carB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r4sa_
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4r4sA (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpltstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltdflrqigdketrldriepdlnegklgdlrdtttpkaiastlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw