PDB entry 4r3v

View 4r3v on RCSB PDB site
Description: Structure of karilysin propeptide and catalytic MMP domain
Class: Hydrolase
Keywords: Metzincin metallopeptidase, Matrix metalloproteinase with unique propeptide, Bacterial matrix metalloproteinase-like enzyme, Hydrolase
Deposited on 2014-08-18, released 2015-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Karilysin
    Species: Tannerella forsythia [TaxId:203275]
    Gene: kly, BFO_2683
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EM77 (2-End)
      • engineered mutation (137)
    Domains in SCOPe 2.07: d4r3va_
  • Chain 'B':
    Compound: Karilysin
    Species: Tannerella forsythia [TaxId:203275]
    Gene: kly, BFO_2683
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EM77 (2-End)
      • engineered mutation (137)
    Domains in SCOPe 2.07: d4r3vb_
  • Heterogens: ZN, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r3vA (A:)
    gpqrlydngpltgdnnyvlqgskwnkttlkyyiynssshlttterenairsafalwsdks
    tlsfiqvynpnqadikikwekgnhgdgypfdgntgilahafypppaggnyaghlhfdgde
    nwsingsgidlitvaahaighllgiehsnvssalmypyytgikrqldnddclavwdlygy
    pfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r3vA (A:)
    qrlydngpltgdnnyvlqgskwnkttlkyyiynssshlttterenairsafalwsdkstl
    sfiqvynpnqadikikwekgnhgdgypfdgntgilahafypppaggnyaghlhfdgdenw
    singsgidlitvaahaighllgiehsnvssalmypyytgikrqldnddclavwdlygyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r3vB (B:)
    gpqrlydngpltgdnnyvlqgskwnkttlkyyiynssshlttterenairsafalwsdks
    tlsfiqvynpnqadikikwekgnhgdgypfdgntgilahafypppaggnyaghlhfdgde
    nwsingsgidlitvaahaighllgiehsnvssalmypyytgikrqldnddclavwdlygy
    pfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r3vB (B:)
    qrlydngpltgdnnyvlqgskwnkttlkyyiynssshlttterenairsafalwsdkstl
    sfiqvynpnqadikikwekgnhgdgypfdgntgilahafypppaggnyaghlhfdgdenw
    singsgidlitvaahaighllgiehsnvssalmypyytgikrqldnddclavwdlygyp