PDB entry 4r3d

View 4r3d on RCSB PDB site
Description: Crystal structure of MERS Coronavirus papain like protease
Class: hydrolase
Keywords: BETA STRANDS, ZINC FINGER, Hydrolase
Deposited on 2014-08-15, released 2015-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-structural protein 3
    Species: Betacoronavirus England 1 [TaxId:1263720]
    Gene: 1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r3da1, d4r3da2
  • Chain 'B':
    Compound: non-structural protein 3
    Species: Betacoronavirus England 1 [TaxId:1263720]
    Gene: 1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r3db1, d4r3db2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r3dA (A:)
    gplgsqqltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghsl
    yladnltadetkalkelygpvdptflhrfyslkaavhkwkmvvcdkvrslklsdnncyln
    avimtldllkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvl
    akaelccsarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhr
    qivehttpwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfds
    gtvsktsdwkckvtdvlfpgqkyssdcnvvrysldg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r3dA (A:)
    ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt
    adetkalkelygpvdptflhrfyslkaavhkwkmvvcdkvrslklsdnncylnavimtld
    llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
    sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqivehtt
    pwlllsgtpneklvttstapdfvafnvfqgghyvharlkgglilkfdsgtvsktsdwkck
    vtdvlfpgqkyssdcnvvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r3dB (B:)
    gplgsqqltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghsl
    yladnltadetkalkelygpvdptflhrfyslkaavhkwkmvvcdkvrslklsdnncyln
    avimtldllkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvl
    akaelccsarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhr
    qivehttpwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfds
    gtvsktsdwkckvtdvlfpgqkyssdcnvvrysldg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r3dB (B:)
    ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt
    adetkalkelygpvdptflhrfyslkaavhkwkmvvcdkvrslklsdnncylnavimtld
    llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
    sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqivehtt
    pwlllsgtpneklvttstapdfvafnvfqgvghyvharlkgglilkfdsgtvsktsdwkc
    kvtdvlfpgqkyssdcnvvr