PDB entry 4r25

View 4r25 on RCSB PDB site
Description: Structure of B. subtilis GlnK
Class: transcription
Keywords: PII family member, nitrogen regulation, TnrA, transcription
Deposited on 2014-08-08, released 2015-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrogen regulatory PII-like protein
  Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
  Gene: nrgB, BSU36520
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07428 (2-113)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d4r25a1, d4r25a2
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4r25A (A:)
  shmfkveivtrpanfeklkqelgkigvtsltfsnvhgcglqkahtelyrgvkiesnvyer
  lkieivvskvpvdqvtetakrvlktgspgdgkifvyeisntinirtgeegpeal