PDB entry 4r11

View 4r11 on RCSB PDB site
Description: A conserved phosphorylation switch controls the interaction between cadherin and beta-catenin in vitro and in vivo
Class: cell adhesion/protein binding
Keywords: armadillo repeat, cell adhesion, phosphorylation, CELL ADHESION-PROTEIN BINDING complex
Deposited on 2014-08-03, released 2015-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein humpback-2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: hmp-2, K05C4.6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r11a_
  • Chain 'B':
    Compound: Cadherin-related hmr-1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: hmr-1, W02B9.1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Protein humpback-2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: hmp-2, K05C4.6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r11c_
  • Chain 'D':
    Compound: Cadherin-related hmr-1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: hmr-1, W02B9.1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Protein humpback-2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: hmp-2, K05C4.6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4r11e_
  • Chain 'F':
    Compound: Cadherin-related hmr-1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: hmr-1, W02B9.1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r11A (A:)
    ggiqmptqqlkqsvmdlltyegsndmsglslpdlvklmcdhdesvvaravhraymlsred
    pnffnapgfdhrsfvealmaaskssnvnvrrnaigalshmseqrggpllifrsgglaeii
    rmlydslesvvhyavttlrnllmhvsdsraqaralnavealtphlhktnpkllaqvadgl
    yflliddapskitflsllgpqilvsilreysdhrkliytvvrcirslsvcpsnkpalisl
    gclpalyvelctakdersqtailvamrnlsdsatneenltqliiklleiirvandgmtac
    acgtlsnltcnntrnkqtvcshggidalvtairrlpeveevtepalcalrhctarhslae
    eaqselrfcqafpvildqletlrtpvikaalgvirnsallqtnlieltqeqtanghtavs
    ltmdilrraitaieenpdiavdgvpmwgviegavsalhqlanhpavaaaccddigqvgnp
    ecppfldllhrllahprlgsmddevlereilgllyqlskrpdgaravestgvsallmesr
    gsqyksvvtyangvlsnlkrgdsaaimnmsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r11A (A:)
    pdlvklmcdhdesvvaravhraymlsredpnffnapgfdhrsfvealmaaskssnvnvrr
    naigalshmseqrggpllifrsgglaeiirmlydslesvvhyavttlrnllmhvsdsraq
    aralnavealtphlhktnpkllaqvadglyflliddapskitflsllgpqilvsilreys
    dhrkliytvvrcirslsvcpsnkpalislgclpalyvelctakdersqtailvamrnlsd
    satneenltqliiklleiirvandgmtacacgtlsnltcnntrnkqtvcshggidalvta
    irrlpeveevtepalcalrhctarhslaeeaqselrfcqafpvildqletlrtpvikaal
    gvirnsallqtnlieltqeqtanghtavsltmdilrraitaieenpdiavdgvpmwgvie
    gavsalhqlanhpavaaaccddigqvgnpecppfldllhrllahprlgsmddevlereil
    gllyqlskrpdgaravestgvsallmesrgsqyksvvtyangvlsnlkrgdsaa
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4r11C (C:)
    ggiqmptqqlkqsvmdlltyegsndmsglslpdlvklmcdhdesvvaravhraymlsred
    pnffnapgfdhrsfvealmaaskssnvnvrrnaigalshmseqrggpllifrsgglaeii
    rmlydslesvvhyavttlrnllmhvsdsraqaralnavealtphlhktnpkllaqvadgl
    yflliddapskitflsllgpqilvsilreysdhrkliytvvrcirslsvcpsnkpalisl
    gclpalyvelctakdersqtailvamrnlsdsatneenltqliiklleiirvandgmtac
    acgtlsnltcnntrnkqtvcshggidalvtairrlpeveevtepalcalrhctarhslae
    eaqselrfcqafpvildqletlrtpvikaalgvirnsallqtnlieltqeqtanghtavs
    ltmdilrraitaieenpdiavdgvpmwgviegavsalhqlanhpavaaaccddigqvgnp
    ecppfldllhrllahprlgsmddevlereilgllyqlskrpdgaravestgvsallmesr
    gsqyksvvtyangvlsnlkrgdsaaimnmsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r11C (C:)
    lslpdlvklmcdhdesvvaravhraymlsredpnffnapgfdhrsfvealmaaskssnvn
    vrrnaigalshmseqrggpllifrsgglaeiirmlydslesvvhyavttlrnllmhvsds
    raqaralnavealtphlhktnpkllaqvadglyflliddapskitflsllgpqilvsilr
    eysdhrkliytvvrcirslsvcpsnkpalislgclpalyvelctakdersqtailvamrn
    lsdsatneenltqliiklleiirvandgmtacacgtlsnltcnntrnkqtvcshggidal
    vtairrlpeveevtepalcalrhctarhslaeeaqselrfcqafpvildqletlrtpvik
    aalgvirnsallqtnlieltqeqtanghtavsltmdilrraitaieenpdiavdgvpmwg
    viegavsalhqlanhpavaaaccddigqvgnpecppfldllhrllahprlgsmddevler
    eilgllyqlskrpdgaravestgvsallmesrgsqyksvvtyangvlsnlkrgdsa
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4r11E (E:)
    ggiqmptqqlkqsvmdlltyegsndmsglslpdlvklmcdhdesvvaravhraymlsred
    pnffnapgfdhrsfvealmaaskssnvnvrrnaigalshmseqrggpllifrsgglaeii
    rmlydslesvvhyavttlrnllmhvsdsraqaralnavealtphlhktnpkllaqvadgl
    yflliddapskitflsllgpqilvsilreysdhrkliytvvrcirslsvcpsnkpalisl
    gclpalyvelctakdersqtailvamrnlsdsatneenltqliiklleiirvandgmtac
    acgtlsnltcnntrnkqtvcshggidalvtairrlpeveevtepalcalrhctarhslae
    eaqselrfcqafpvildqletlrtpvikaalgvirnsallqtnlieltqeqtanghtavs
    ltmdilrraitaieenpdiavdgvpmwgviegavsalhqlanhpavaaaccddigqvgnp
    ecppfldllhrllahprlgsmddevlereilgllyqlskrpdgaravestgvsallmesr
    gsqyksvvtyangvlsnlkrgdsaaimnmsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r11E (E:)
    dlvklmcdhdesvvaravhraymlsrhrsfvealmaaskssnvnvrrnaigalshmseqr
    ggpllifrsgglaeiirmlydslesvvhyavttlrnllmhvsdsraqaralnavealtph
    lhktnpkllaqvadglyflliddapskitflsllgpqilvsilreysdhrkliytvvrci
    rslsvcpsnkpalislgclpalyvelctakdersqtailvamrnlsdsatneenltqlii
    klleiirvandgmtacacgtlsnltcnntrnkqtvcshggidalvtairrlpeveevtep
    alcalrhctarhslaeeaqselrfcqafpvildqletlrtpvikaalgvirnsallqtnl
    ieltqeqtanghtavsltmdilrraitaieenpdiavdgvpmwgviegavsalhqlanhp
    avaaaccddcppfldllhrllahprlgsmddevlereilgllyqlskrpdgaravestgv
    sallmesrgsqyksvvtyangvlsnlkr
    

  • Chain 'F':
    No sequence available.