PDB entry 4r06

View 4r06 on RCSB PDB site
Description: Crystal Structure of SR2067 bound to PPARgamma
Class: transcription
Keywords: nuclear receptor, ligand binding protein, TRANSCRIPTION
Deposited on 2014-07-30, released 2016-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C3, PPARG, PPARG_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r06a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C3, PPARG, PPARG_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r06b_
  • Heterogens: 3E7, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r06A (A:)
    npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikf
    khitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhe
    iiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdl
    aifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrq
    ivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r06A (A:)
    pesadlralakhlydsyiksfpltkakarailtttdkspfviydmnslmmgeevairifq
    gcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlise
    gqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnv
    kpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdm
    slhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r06B (B:)
    npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikf
    khitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhe
    iiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdl
    aifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrq
    ivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r06B (B:)
    esadlralakhlydsyiksfpltkakarailtgkspfviydmnslmmgedkikfkhitev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetpllqeiykd