PDB entry 4qyw

View 4qyw on RCSB PDB site
Description: Structure of phosphono-CheY from T.maritima
Class: signaling protein
Keywords: phosphono-CheY, alpha beta globular protein, SIGNALING PROTEIN
Deposited on 2014-07-25, released 2015-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Thermotoga maritima [TaxId:243274]
    Gene: cheY, TM_0700
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56312 (0-End)
      • engineered mutation (52)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4qywa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qywA (A:)
    gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmcitmpemn
    gidaikeimkidpnakiivasamgqqamvieaikagakdfivkpfqpsrvvealnkvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qywA (A:)
    gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmcitmpemn
    gidaikeimkidpnakiivasamgqqamvieaikagakdfivkpfqpsrvvealnkvs