PDB entry 4qy6

View 4qy6 on RCSB PDB site
Description: Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2014-07-23, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM, Beta-lactamase PSE-4
    Species: Escherichia coli, Pseudomonas aeruginosa [TaxId:562, 287]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6, pse4, carB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qy6a_
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qy6A (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpltstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltdflrqigdketrldriepdlnegklgdlrdtttpkaiastlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw