PDB entry 4qy5

View 4qy5 on RCSB PDB site
Description: Crystal structures of chimeric beta-lactamase cTEM-19m showing different conformations
Class: hydrolase
Keywords: Hydrolase
Deposited on 2014-07-23, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-lactamase TEM,Beta-lactamase PSE-4
  Species: Escherichia coli, Pseudomonas aeruginosa [TaxId:562, 287]
  Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6, pse4, carB1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62593 (0-41)
  • Uniprot P16897 (42-43)
  • Uniprot P62593 (44-123)
  • Uniprot P16897 (124-164)
  • Uniprot P62593 (165-262)
  Domains in SCOPe 2.06: d4qy5a_
• Heterogens: CL, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4qy5A (A:)
  hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpltstfkvllcgavlsrvd
  agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
  keltdflrqigdketrldriepdlnegklgdlrdtttpkaiastlrklltgelltlasrq
  qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
  sqatmdernrqiaeigaslikhw