PDB entry 4qxu

View 4qxu on RCSB PDB site
Description: Novel Inhibition Mechanism of Membrane Metalloprotease by an Exosite-Swiveling Conformational antibody
Class: immune system
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, Israel Structural Proteomics Center, ISPC, Igg fold, IMMUNE SYSTEM
Deposited on 2014-07-22, released 2014-12-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.246
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti_MT1-MMP Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4QXU (0-End)
  • Chain 'K':
    Compound: Matrix metalloproteinase-14
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP14
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: anti_MT1-MMP light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4QXU (0-218)
    Domains in SCOPe 2.06: d4qxul1, d4qxul2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qxuL (L:)
    dvlmtqtplslpvglgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshapytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec