PDB entry 4qxk

View 4qxk on RCSB PDB site
Description: Joint X-ray/neutron structure of PKGIbeta in complex with cGMP
Class: signaling protein
Keywords: cyclic GMP (cGMP), Type I cGMP Dependent Protein Kinase (PKG I), Cyclic Nucleotide Selectivity, Serine/threonine Protein Kinase, Signal Transduction, Second Messengers, Hydrogen Bonding, Solvent Accessibility, SIGNALING PROTEIN
Deposited on 2014-07-21, released 2014-11-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAYNEUT
Resolution: 2.2 Å
R-factor: 0.277
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1, PRKG1B, PRKGR1A, PRKGR1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qxka_
  • Heterogens: PCG, NA, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qxkA (A:)
    gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii
    skgtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsf
    khligglddvsnkayedaeakakyeaeaaffan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qxkA (A:)
    khteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtvn
    vtredspdpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhliggld
    dvsnkay