PDB entry 4qxg

View 4qxg on RCSB PDB site
Description: Antigen binding fragment of an anti IFNAR1 antibody
Class: immune system
Keywords: IgV and IgC type folds, antigen binding, IFNAR1, interferon alpha receptor 1, IMMUNE SYSTEM
Deposited on 2014-07-20, released 2015-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab, heavy chain, IgG1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4QXG (0-End)
  • Chain 'L':
    Compound: Fab, light chain, IgG1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4QXG (0-End)
    Domains in SCOPe 2.07: d4qxgl1, d4qxgl2
  • Heterogens: K, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4qxgL (L:)
    eivltqspgtlslspgeratlscrasqsvsssffawyqqkpgqaprlliygassratgip
    drlsgsgsgtdftltitrlepedfavyycqqydssaitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qxgL (L:)
    eivltqspgtlslspgeratlscrasqsvsssffawyqqkpgqaprlliygassratgip
    drlsgsgsgtdftltitrlepedfavyycqqydssaitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge