PDB entry 4qvw

View 4qvw on RCSB PDB site
Description: yCP beta5-A49S-mutant in complex with bortezomib
Class: hydrolase/hydrolase inhibitor
Keywords: Cancer, Proteasome, Drug Resistance, Binding Analysis, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-07-16, released 2015-02-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.177
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome subunit alpha type-2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwa_
  • Chain 'B':
    Compound: Proteasome subunit alpha type-3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwb_
  • Chain 'C':
    Compound: Proteasome subunit alpha type-4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwc_
  • Chain 'D':
    Compound: Proteasome subunit alpha type-5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Proteasome subunit alpha type-6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwe_
  • Chain 'F':
    Compound: probable proteasome subunit alpha type-7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwf_
  • Chain 'G':
    Compound: Proteasome subunit alpha type-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwg_
  • Chain 'H':
    Compound: Proteasome subunit beta type-2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwh_
  • Chain 'I':
    Compound: Proteasome subunit beta type-3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwi_
  • Chain 'J':
    Compound: Proteasome subunit beta type-4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwj_
  • Chain 'K':
    Compound: Proteasome subunit beta type-5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PRE2, DOA3, PRG1, YPR103W, P8283.10
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30656 (0-211)
      • engineered mutation (48)
    Domains in SCOPe 2.06: d4qvwk_
  • Chain 'L':
    Compound: Proteasome subunit beta type-6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwl_
  • Chain 'M':
    Compound: Proteasome subunit beta type-7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwm_
  • Chain 'N':
    Compound: Proteasome subunit beta type-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwn_
  • Chain 'O':
    Compound: Proteasome subunit alpha type-2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwo_
  • Chain 'P':
    Compound: Proteasome subunit alpha type-3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwp_
  • Chain 'Q':
    Compound: Proteasome subunit alpha type-4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwq_
  • Chain 'R':
    Compound: Proteasome subunit alpha type-5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Proteasome subunit alpha type-6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvws_
  • Chain 'T':
    Compound: probable proteasome subunit alpha type-7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwt_
  • Chain 'U':
    Compound: Proteasome subunit alpha type-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwu_
  • Chain 'V':
    Compound: Proteasome subunit beta type-2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwv_
  • Chain 'W':
    Compound: Proteasome subunit beta type-3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvww_
  • Chain 'X':
    Compound: Proteasome subunit beta type-4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwx_
  • Chain 'Y':
    Compound: Proteasome subunit beta type-5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PRE2, DOA3, PRG1, YPR103W, P8283.10
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30656 (0-211)
      • engineered mutation (48)
    Domains in SCOPe 2.06: d4qvwy_
  • Chain 'Z':
    Compound: Proteasome subunit beta type-6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qvwz_
  • Chain 'a':
    Compound: Proteasome subunit beta type-7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome subunit beta type-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, CL, BO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qvwA (A:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qvwB (B:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwB (B:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qvwC (C:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwC (C:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4qvwE (E:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwE (E:)
    nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
    ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
    ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
    gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4qvwF (F:)
    mtsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllv
    pqknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyv
    qahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklv
    dhhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeai
    dfaqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwF (F:)
    tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
    kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
    ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
    glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
    ein
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4qvwG (G:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwG (G:)
    gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
    yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
    raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
    idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
    q
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4qvwH (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwH (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4qvwI (I:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwI (I:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4qvwJ (J:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwJ (J:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddf
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qvwK (K:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggsadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qvwL (L:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4qvwM (M:)
    tqianagaspmvntqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgd
    ntvvgisgdisdmqhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskm
    nplwnaiivagvqsngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipk
    ttvqvaeeaivnamrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikg
    ygtqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwM (M:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qvwN (N:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qvwO (O:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4qvwP (P:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwP (P:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4qvwQ (Q:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwQ (Q:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4qvwS (S:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwS (S:)
    nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
    ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
    ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
    gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4qvwT (T:)
    mtsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllv
    pqknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyv
    qahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklv
    dhhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeai
    dfaqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwT (T:)
    tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
    kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
    ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
    glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
    ein
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4qvwU (U:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwU (U:)
    gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
    yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
    raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
    idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
    q
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4qvwV (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwV (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4qvwW (W:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwW (W:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4qvwX (X:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qvwX (X:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddf
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qvwY (Y:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggsadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qvwZ (Z:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.