PDB entry 4quc

View 4quc on RCSB PDB site
Description: Crystal structure of chromodomain of Rhino
Class: protein binding
Keywords: histone binding, protein binding
Deposited on 2014-07-10, released 2014-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.213
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RE36324p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG10683, Dmel_CG10683, rhi, rhino
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4quca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qucA (A:)
    sdhveeyvvekilgkrfvngrpqvlvkwsgfpnenntweplenvgncmklvsdfesevfr
    lhrkaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qucA (A:)
    eyvvekilgkrfvngrpqvlvkwsgfpnenntweplenvgncmklvsdfesevfrl