PDB entry 4qsv

View 4qsv on RCSB PDB site
Description: Structure of the bromodomain of human ATPase family AAA domain-containing protein 2 (ATAD2) in complex with thymidine
Class: signaling protein
Keywords: Structural Genomics Consortium (SGC), SIGNALING PROTEIN, bromodomain, actyl-lysine binding, ATPase family AAA domain-containing protein 2, epigenetics
Deposited on 2014-07-06, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATPase family AAA domain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: ATAD2, L16, PRO2000
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6PL18 (2-129)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d4qsva1, d4qsva2
• Heterogens: SO4, EDO, THM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4qsvA (A:)
  smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
  dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
  qlceeiqesr