PDB entry 4qrh

View 4qrh on RCSB PDB site
Description: Molecular mechanism and evolution of guanylate kinase regulation by (p)ppGpp
Class: transferase
Keywords: Guanylate Kinase, phosphotransferase, pppGpp, TRANSFERASE
Deposited on 2014-07-01, released 2015-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Staphylococcus aureus USA300-ISMMS1 [TaxId:1458279]
    Gene: gmk, AZ30_05805
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qrha_
  • Chain 'B':
    Compound: Guanylate kinase
    Species: Staphylococcus aureus USA300-ISMMS1 [TaxId:1458279]
    Gene: gmk, AZ30_05805
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qrhb_
  • Chain 'C':
    Compound: Guanylate kinase
    Species: Staphylococcus aureus USA300-ISMMS1 [TaxId:1458279]
    Gene: gmk, AZ30_05805
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qrhc_
  • Chain 'D':
    Compound: Guanylate kinase
    Species: Staphylococcus aureus USA300-ISMMS1 [TaxId:1458279]
    Gene: gmk, AZ30_05805
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qrhd_
  • Heterogens: SO4, MG, K, 0O2, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qrhA (A:)
    snamdnekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyff
    ktrdafealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfp
    dalfiflappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelak
    nriqciveaehlkrerveakyrkmileakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qrhA (A:)
    nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda
    fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi
    flappslehlnearkevemmnlydyvvvndevelaknriqciveaehlkrerveakyrkm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qrhB (B:)
    snamdnekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyff
    ktrdafealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfp
    dalfiflappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelak
    nriqciveaehlkrerveakyrkmileakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qrhB (B:)
    dnekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrd
    afealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalf
    iflappslehlnearkevemmnlydyvvvndevelaknriqciveaehlkrerveakyrk
    mileak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qrhC (C:)
    snamdnekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyff
    ktrdafealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfp
    dalfiflappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelak
    nriqciveaehlkrerveakyrkmileakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qrhC (C:)
    nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda
    fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi
    flappslehlinearkevemmnlydyvvvndevelaknriqciveaehlkrerveakyrk
    milea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4qrhD (D:)
    snamdnekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyff
    ktrdafealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfp
    dalfiflappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelak
    nriqciveaehlkrerveakyrkmileakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qrhD (D:)
    nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda
    fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi
    flappslehliqsrinearkevemmnlydyvvvndevelaknriqciveaehlkrervea
    kyrk