PDB entry 4qqp

View 4qqp on RCSB PDB site
Description: Crystal structure of C1QL3 mutant D207A
Class: protein binding
Keywords: Jelly roll fold, C1q, Brain-specific angiogenesis inhibitor G-protein coupled receptor 3, extracellular, PROTEIN BINDING
Deposited on 2014-06-27, released 2015-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ESN4 (Start-136)
      • engineered mutation (88)
    Domains in SCOPe 2.06: d4qqpa_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qqpA (A:)
    atystvpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvl
    mrggdgtsmwadlcknnqvrasaiaqdaaqnydyasnsvvlhlepgdevyikldggkahg
    gnnnkystfsgfiiyad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qqpA (A:)
    kiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggdgt
    smwadlcknnqvrasaiaqdaaqnydyasnsvvlhlepgdevyikldggkahggnnnkys
    tfsgfiiyad