PDB entry 4qq2

View 4qq2 on RCSB PDB site
Description: Crystal structure of C1QL1
Class: protein binding
Keywords: Jelly roll fold, C1q, Brain-specific angiogenesis inhibitor G-protein coupled receptor, extracellular, PROTEIN BINDING
Deposited on 2014-06-26, released 2015-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c1q-related factor
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql1, C1qrf, Crf, Ctrp14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qq2a_
  • Chain 'B':
    Compound: c1q-related factor
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql1, C1qrf, Crf, Ctrp14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qq2b_
  • Chain 'C':
    Compound: c1q-related factor
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql1, C1qrf, Crf, Ctrp14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qq2c_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qq2A (A:)
    atyttvprvafyaglknphegyevlkfddvvtnlgnnydaasgkftcnipgtyfftyhvl
    mrggdgtsmwadlckngqvrasaiaqdadqnydyasnsvilhldagdevfikldggkahg
    gnsnkystfsgfiiysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qq2A (A:)
    prvafyaglknphegyevlkfddvvtnlgnnydaasgkftcnipgtyfftyhvlmrggdg
    tsmwadlckngqvrasaiaqdadqnydyasnsvilhldagdevfikldggkahggnsnky
    stfsgfiiysd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qq2B (B:)
    atyttvprvafyaglknphegyevlkfddvvtnlgnnydaasgkftcnipgtyfftyhvl
    mrggdgtsmwadlckngqvrasaiaqdadqnydyasnsvilhldagdevfikldggkahg
    gnsnkystfsgfiiysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qq2B (B:)
    prvafyaglknphegyevlkfddvvtnlgnnydaasgkftcnipgtyfftyhvlmrggdg
    tsmwadlckngqvrasaiaqdadqnydyasnsvilhldagdevfikldggkahggnsnky
    stfsgfiiysd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qq2C (C:)
    atyttvprvafyaglknphegyevlkfddvvtnlgnnydaasgkftcnipgtyfftyhvl
    mrggdgtsmwadlckngqvrasaiaqdadqnydyasnsvilhldagdevfikldggkahg
    gnsnkystfsgfiiysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qq2C (C:)
    rvafyaglknphegyevlkfddvvtnlgnnydaasgkftcnipgtyfftyhvlmrggdgt
    smwadlckngqvrasaiaqdadqnydyasnsvilhldagdevfikldggkahggnsnkys
    tfsgfiiysd