PDB entry 4qpj

View 4qpj on RCSB PDB site
Description: 2.7 Angstrom Structure of a Phosphotransferase in Complex with a Receiver Domain
Class: signaling protein/DNA binding protein
Keywords: ChpT-CtrA complex, Hpt, RR, Response Regulator, ChpT, CtrA, Histidine kinase, Histidine kinase like, catalytic domain, ATP-binding, Phosphotransferase, SIGNALING PROTEIN-DNA BINDING PROTEIN complex
Deposited on 2014-06-23, released 2015-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphotransferase
    Species: Brucella abortus [TaxId:359391]
    Gene: BAB1_1613, BruAb1_1585
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YQA5 (Start-242)
      • see remark 999 (61)
  • Chain 'B':
    Compound: Phosphotransferase
    Species: Brucella abortus [TaxId:359391]
    Gene: BAB1_1613, BruAb1_1585
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YQA5 (34-242)
      • see remark 999 (61)
  • Chain 'C':
    Compound: Cell cycle response regulator CtrA
    Species: Brucella abortus [TaxId:359391]
    Gene: BAB1_1614, BruAb1_1586, ctrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YQA4 (34-151)
      • expression tag (32-33)
    Domains in SCOPe 2.05: d4qpjc_
  • Chain 'D':
    Compound: Cell cycle response regulator CtrA
    Species: Brucella abortus [TaxId:359391]
    Gene: BAB1_1614, BruAb1_1586, ctrA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YQA4 (34-151)
      • expression tag (31-33)
    Domains in SCOPe 2.05: d4qpjd_
  • Heterogens: GOL, NA, CA, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4qpjC (C:)
mgsshhhhhhssglvprgshmasmtggqqmgrgsmrvllieddsaiaqsielmlksesfn
vyttdlgeegidlgklydydiilldlnlpdmsgyevlrtlrlskvktpililsgmagied
kvrglgfgaddymtkpfhkdeliarihaivrr

    Sequence, based on observed residues (ATOM records): (download) 
    >4qpjC (C:)
gsmrvllieddsaiaqsielmlksesfnvyttdlgeegidlgklydydiilldlnlpdms
gyevlrtlrlskvktpililsgmagiedkvrglgfgaddymtkpfhkdeliarihaivrr

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >4qpjD (D:)
mgsshhhhhhssglvprgshmasmtggqqmgrgsmrvllieddsaiaqsielmlksesfn
vyttdlgeegidlgklydydiilldlnlpdmsgyevlrtlrlskvktpililsgmagied
kvrglgfgaddymtkpfhkdeliarihaivrr

    Sequence, based on observed residues (ATOM records): (download) 
    >4qpjD (D:)
rgsmrvllieddsaiaqsielmlksesfnvyttdlgeegidlgklydydiilldlnlpdm
sgyevlrtlrlskvktpililsgmagiedkvrglgfgaddymtkpfhkdeliarihaivr
r