PDB entry 4qp0

View 4qp0 on RCSB PDB site
Description: Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei
Class: Hydrolase
Keywords: Tim Barrel, Hydrolase, extracellular
Deposited on 2014-06-22, released 2014-11-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-mannanase
    Species: Rhizomucor miehei [TaxId:4839]
    Gene: Man5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qp0a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qp0A (A:)
    assfvqtsgpqftldgkpfyfegtnayylmtsdqsnvkqvfsdmkslglpvvrtwlfnlg
    sdsvwfqqwdsssnkmvindnsdtglgridyiiqqaasqdikliftlnnnwedyggmdyy
    vknfggtyhddfytntemidsfkeyishvlnrensltgvkykddptifgweianeprcvg
    sgdfpassncsttvttawikeiseyiksidsnhlvavgdegffnrkgesdyeynggsgmd
    fdailalssidfgtfhlypeawskgtdsswsvqwikdhaaaqadadkpvimeeyglstda
    lrvaqypvwqgtvededlaadafwqiavpcstmdgfgicasdndiattvtnhadamakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qp0A (A:)
    sfvqtsgpqftldgkpfyfegtnayylmtsdqsnvkqvfsdmkslglpvvrtwlfnlgsd
    svwfqqwdsssnkmvindnsdtglgridyiiqqaasqdikliftlnnnwedyggmdyyvk
    nfggtyhddfytntemidsfkeyishvlnrensltgvkykddptifgweianeprcvgsg
    dfpassncsttvttawikeiseyiksidsnhlvavgdegffnrkgesdyeynggsgmdfd
    ailalssidfgtfhlypeawskgtdsswsvqwikdhaaaqadadkpvimeeyglstdalr
    vaqypvwqgtvededlaadafwqiavpcstmdgfgicasdndiattvtnhadamakk