PDB entry 4qo1

View 4qo1 on RCSB PDB site
Description: p53 DNA binding domain in complex with Nb139
Class: Apoptosis, transcription
Keywords: Immunoglobulin fold, DNA binding, Apoptosis, transcription
Deposited on 2014-06-19, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.167
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nb139 Nanobody against the DNA-binding domain of p53
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4QO1
    Domains in SCOPe 2.07: d4qo1a_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qo1b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qo1A (A:)
    aqvqlqesggglvqaggslrlscaasertfstyamgwfrqapgrereflaqinwsgttty
    yaesvkdrttisrdnakntvylemnnlnaddtgiyfcaahpqrgwgstlgwtywgqgtqv
    tvssggggsgggkpipnpllgldstrtghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qo1A (A:)
    vqlqesggglvqaggslrlscaasertfstyamgwfrqapgrereflaqinwsgtttyya
    esvkdrttisrdnakntvylemnnlnaddtgiyfcaahpqrgwgstlgwtywgqgtqvtv
    ssggggs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qo1B (B:)
    plsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstp
    ppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrnt
    frhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfe
    vrvcacpgrdrrteeenlrkkgephhelppgstkralpnnthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qo1B (B:)
    plsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstp
    ppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrnt
    frhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfe
    vrvcacpgrdrrteeenlr