PDB entry 4qnj

View 4qnj on RCSB PDB site
Description: The structure of wt A. thaliana IGPD2 in complex with Mn2+ and formate at 1.3A resolution
Class: lyase
Keywords: hydro-lyase, histidine biosynthesis, manganese binding, chloroplastic, LYASE
Deposited on 2014-06-18, released 2015-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qnja1, d4qnja2
  • Heterogens: MN, FMT, TRS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qnjA (A:)
    maspiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhv
    ratgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrp
    ylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafara
    lrqatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnjA (A:)
    arigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdth
    iddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqates
    dprr