PDB entry 4qnh

View 4qnh on RCSB PDB site
Description: Calcium-calmodulin (T79D) complexed with the calmodulin binding domain from a small conductance potassium channel SK2-a
Class: ion transport/protein binding
Keywords: ion channel, ion transport-protein binding complex
Deposited on 2014-06-17, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.184
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Small conductance calcium-activated potassium channel protein 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: KCNN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70604 (2-93)
      • expression tag (1)
      • expression tag (94-95)
    Domains in SCOPe 2.07: d4qnhb1, d4qnhb2, d4qnhb3
  • Chain 'R':
    Compound: calmodulin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Calm1, Calm, Cam, Cam1, Calm2, Cam2, Camb, Calm3, Cam3, Camc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62161
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4qnhr_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qnhB (B:)
    mgrkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhq
    rkflqaihqlrsvkmeqrklndqantlvdlaktqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnhB (B:)
    grkleltkaedtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihq
    lrsvkmeqrklndqantlvdlaktqle
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4qnhR (R:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdddseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnhR (R:)
    dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
    tidfpefltmmarkmkdddseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev
    demireadidgdgqvnyeefvqmmta