PDB entry 4qm0

View 4qm0 on RCSB PDB site
Description: Crystal structure of RORc in complex with a tertiary sulfonamide inverse agonist
Class: Transcription/Transcription inhibitor
Keywords: nuclear receptor ligand binding domain, Transcription-Transcription inhibitor complex
Deposited on 2014-06-14, released 2014-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.186
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qm0a_
  • Chain 'C':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (Start-247)
      • expression tag (248-250)
    Domains in SCOPe 2.07: d4qm0c1, d4qm0c2
  • Heterogens: 39K, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qm0A (A:)
    gsapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwer
    cahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffe
    gkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkv
    eqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafp
    plykelfsgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qm0A (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qm0C (C:)
    gsapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwer
    cahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffe
    gkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkv
    eqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafp
    plykelfsgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qm0C (C:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqqaafpplykelfsgns