PDB entry 4qlt

View 4qlt on RCSB PDB site
Description: yCP in complex with tripeptidic epoxyketone inhibitor 2 (PR924)
Class: hydrolase/hydrolase inhibitor
Keywords: Proteasome, Epoxyketone, Immunoproteasome Inhibitor, Binding Analysis, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-06-13, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.178
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome subunit alpha type-2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qlta_
  • Chain 'B':
    Compound: Proteasome subunit alpha type-3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Proteasome subunit alpha type-4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltc_
  • Chain 'D':
    Compound: Proteasome subunit alpha type-5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltd_
  • Chain 'E':
    Compound: Proteasome subunit alpha type-6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qlte_
  • Chain 'F':
    Compound: probable proteasome subunit alpha type-7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltf_
  • Chain 'G':
    Compound: Proteasome subunit alpha type-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltg_
  • Chain 'H':
    Compound: Proteasome subunit beta type-2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qlth_
  • Chain 'I':
    Compound: Proteasome subunit beta type-3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qlti_
  • Chain 'J':
    Compound: Proteasome subunit beta type-4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltj_
  • Chain 'K':
    Compound: Proteasome subunit beta type-5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltk_
  • Chain 'L':
    Compound: Proteasome subunit beta type-6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltl_
  • Chain 'M':
    Compound: Proteasome subunit beta type-7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltm_
  • Chain 'N':
    Compound: Proteasome subunit beta type-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltn_
  • Chain 'O':
    Compound: Proteasome subunit alpha type-2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qlto_
  • Chain 'P':
    Compound: Proteasome subunit alpha type-3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltp_
  • Chain 'Q':
    Compound: Proteasome subunit alpha type-4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltq_
  • Chain 'R':
    Compound: Proteasome subunit alpha type-5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltr_
  • Chain 'S':
    Compound: Proteasome subunit alpha type-6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qlts_
  • Chain 'T':
    Compound: probable proteasome subunit alpha type-7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltt_
  • Chain 'U':
    Compound: Proteasome subunit alpha type-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltu_
  • Chain 'V':
    Compound: Proteasome subunit beta type-2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltv_
  • Chain 'W':
    Compound: Proteasome subunit beta type-3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltw_
  • Chain 'X':
    Compound: Proteasome subunit beta type-4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltx_
  • Chain 'Y':
    Compound: Proteasome subunit beta type-5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qlty_
  • Chain 'Z':
    Compound: Proteasome subunit beta type-6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltz_
  • Chain 'a':
    Compound: Proteasome subunit beta type-7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome subunit beta type-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qltb_
  • Heterogens: MG, MES, 39V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qltA (A:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qltC (C:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltC (C:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4qltD (D:)
    mfltrseydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratsplle
    sdsiekiveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdla
    lrfgegasgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaq
    aellnewhssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaeli
    kelkekeaaespeeadvems
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltD (D:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
    rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
    aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4qltE (E:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltE (E:)
    nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
    ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
    ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
    gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4qltF (F:)
    mtsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllv
    pqknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyv
    qahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklv
    dhhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeai
    dfaqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltF (F:)
    tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
    kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
    ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
    glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
    ein
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4qltG (G:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltG (G:)
    gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
    yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
    raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
    idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
    q
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4qltH (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltH (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4qltI (I:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltI (I:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4qltJ (J:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltJ (J:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddf
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qltK (K:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qltL (L:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4qltM (M:)
    tqianagaspmvntqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgd
    ntvvgisgdisdmqhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskm
    nplwnaiivagvqsngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipk
    ttvqvaeeaivnamrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikg
    ygtqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltM (M:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qltN (N:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qltO (O:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4qltP (P:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltP (P:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4qltQ (Q:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltQ (Q:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4qltR (R:)
    mfltrseydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratsplle
    sdsiekiveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdla
    lrfgegasgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaq
    aellnewhssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaeli
    kelkekeaaespeeadvems
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltR (R:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
    rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
    aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4qltS (S:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltS (S:)
    nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
    ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
    ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
    gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4qltT (T:)
    mtsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllv
    pqknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyv
    qahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklv
    dhhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeai
    dfaqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltT (T:)
    tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
    kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
    ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
    glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
    ein
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4qltU (U:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltU (U:)
    gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
    yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
    raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
    idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
    q
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4qltV (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltV (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4qltW (W:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltW (W:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4qltX (X:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qltX (X:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddf
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qltY (Y:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qltZ (Z:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qltb (b:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql