PDB entry 4qkg

View 4qkg on RCSB PDB site
Description: Monomeric form of human LLT1, a ligand for NKR-P1
Class: immune system
Keywords: C-type lectin like fold, ligand for human receptor NKR-P1, glycosylation; deglycosylated after the first GlcNac unit, anchored in membrane on cell surface, IMMUNE SYSTEM
Deposited on 2014-06-06, released 2015-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 2 member D
    Species: Homo sapiens [TaxId:9606]
    Gene: CLAX, CLEC2B, CLEC2D, LLT1, OCIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHP7 (3-122)
      • engineered mutation (107)
      • expression tag (123-124)
    Domains in SCOPe 2.07: d4qkga1, d4qkga2
  • Heterogens: SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qkgA (A:)
    itgqaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgp
    sdhwiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksd
    ihvgtkhhhhhhhhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkgA (A:)
    qaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsdh
    wiglsreqgqpwkwigecaylndkgassarcyterkwicsksdihvgt