PDB entry 4qgy

View 4qgy on RCSB PDB site
Description: Camelid (llama) nanobody n25 (VHH) against type 6 secretion system TssM protein
Class: immune system
Keywords: immunoglobulin domain, protein recognition, T6SS TssM, IMMUNE SYSTEM
Deposited on 2014-05-26, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nanobody n25, VH domain
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4QGY (0-134)
    Domains in SCOPe 2.07: d4qgya1, d4qgya2
  • Chain 'B':
    Compound: nanobody n25, VH domain
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4QGY (0-End)
    Domains in SCOPe 2.07: d4qgyb1, d4qgyb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qgyA (A:)
    qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
    pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqgiyctdyiigpygmdywg
    kgtqvtvsshhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qgyB (B:)
    qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
    pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqgiyctdyiigpygmdywg
    kgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qgyB (B:)
    qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
    pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqctdyiigpygmdywgkgt
    qvtvss