PDB entry 4qfm

View 4qfm on RCSB PDB site
Description: The structure of aIF2gamma subunit D152A from archaeon Sulfolobus solfataricus complexed with GDPCP
Class: translation
Keywords: gamma subunit, g-protein, translation, translation initiation,protein biosynthesis, RNA-binding, GTP-binding,nucleotide-binding
Deposited on 2014-05-21, released 2015-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q980A5 (Start-414)
      • engineered mutation (151)
    Domains in SCOPe 2.05: d4qfma1, d4qfma2, d4qfma3
  • Heterogens: GCP, MG, FMT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qfmA (A:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvavvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qfmA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvavvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei