PDB entry 4qez

View 4qez on RCSB PDB site
Description: Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Bacillus anthracis
Class: hydrolase
Keywords: Amino-acid biosynthesis, Methionine biosynthesis, HYDROLASE
Deposited on 2014-05-19, released 2014-06-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.243
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: mtnN, BA_4602, GBAA_4602, BAS4270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qeza_
  • Chain 'B':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: mtnN, BA_4602, GBAA_4602, BAS4270
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81LL4 (Start-230)
      • expression tag (231-236)
    Domains in SCOPe 2.06: d4qezb1, d4qezb2
  • Chain 'C':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: mtnN, BA_4602, GBAA_4602, BAS4270
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81LL4 (Start-230)
      • expression tag (231-236)
    Domains in SCOPe 2.06: d4qezc1, d4qezc2
  • Heterogens: ADE, TRS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qezA (A:)
    mriavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstt
    illerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfk
    adealvalaekcmqaeeniqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaava
    qvchqyevpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleelklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qezA (A:)
    riavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstti
    llerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfka
    dealvalaekcmqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaavaqvchqye
    vpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qezB (B:)
    mriavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstt
    illerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfk
    adealvalaekcmqaeeniqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaava
    qvchqyevpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleelklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qezB (B:)
    riavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstti
    llerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfka
    dealvalaekcmqqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaavaqvchqy
    evpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleelklehhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qezC (C:)
    mriavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstt
    illerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfk
    adealvalaekcmqaeeniqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaava
    qvchqyevpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleelklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qezC (C:)
    riavigameeevrilrdkleqaetetvagceftkgqlaghevillksgigkvnaamstti
    llerykpekvintgsaggfhhslnvgdvvistevrhhdvdvtafnyeygqvpgmppgfka
    dealvalaekcmqqvvkgmiatgdsfmsdpnrvaairdkfenlyavemeaaavaqvchqy
    evpfviiralsdiagkesnvsfdqfldqaalhstnfivkvleelklehhhh