PDB entry 4qc3

View 4qc3 on RCSB PDB site
Description: Crystal structure of human BAZ2B bromodomain in complex with a diacetylated histone 4 peptide (H4K8acK12ac)
Class: transcription
Keywords: Bromodomain adjacent to zinc finger domain protein 2B, hWALp4, KIAA1476, transcriptional regulation, Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on 2014-05-09, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-106)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4qc3a1, d4qc3a2
  • Chain 'B':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-106)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4qc3b1, d4qc3b2
  • Chain 'C':
    Compound: diacetylated histone 4 peptide (H4K8acK12ac)
    Database cross-references and differences (RAF-indexed):
    • PDB 4QC3 (0-6)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4qc3A (A:)
smdskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstireklssgqy
pnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4qc3B (B:)
smdskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstireklssgqy
pnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

  • Chain 'C':
    No sequence available.