PDB entry 4qbm
View 4qbm on RCSB PDB site
Description: Crystal structure of human BAZ2A bromodomain in complex with a diacetylated histone 4 peptide (H4K16acK20ac)
Class: Transcription
Keywords: Bromodomain adjacent to zinc finger domain protein 2A, Transcription termination factor I-interacting protein 5, Tip5, Bromodomain, Structural Genomics Consortium, SGC, Transcription
Deposited on
2014-05-08, released
2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated
2015-04-22, with a file datestamp of
2015-04-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain adjacent to zinc finger domain protein 2A
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2A, CB1_000449039, KIAA0314, TIP5
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4qbma1, d4qbma2 - Chain 'B':
Compound: Bromodomain adjacent to zinc finger domain protein 2A
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2A, CB1_000449039, KIAA0314, TIP5
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4qbmb1, d4qbmb2 - Chain 'C':
Compound: histone H4 peptide with sequence Gly-Ala-Lys(ac)-Arg-His-Arg-Lys(ac)-Val-Leu
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: histone H4 peptide with sequence Gly-Ala-Lys(ac)-Arg-His-Arg-Lys(ac)-Val-Leu
Database cross-references and differences (RAF-indexed):
- Heterogens: EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4qbmA (A:)
smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
sseefaadallvfdncqtfneddsevgkaghimrrffesrweefyq
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4qbmB (B:)
smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
sseefaadallvfdncqtfneddsevgkaghimrrffesrweefyq
Sequence, based on observed residues (ATOM records): (download)
>4qbmB (B:)
smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
sseefaadallvfdncqtfneddsevgkaghimrrffesrweefy
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.