PDB entry 4qb4

View 4qb4 on RCSB PDB site
Description: Crystal Structure of Staphylococcal Nuclease mutant V23L/L25V/V66L
Class: hydrolase
Keywords: Hydrolase
Deposited on 2014-05-06, released 2014-06-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-135)
      • engineered mutation (17)
      • engineered mutation (19)
      • engineered mutation (60)
    Domains in SCOPe 2.08: d4qb4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4qb4A (A:)
klhkepatlikaidgdtlkvmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
lenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
rkseaqakkeklniws