PDB entry 4qah

View 4qah on RCSB PDB site
Description: The second sphere residue T263 is important for function and activity of PTP1B through modulating WPD loop
Class: hydrolase
Keywords: Tyrosine phosphorylation, HYDROLASE
Deposited on 2014-05-05, released 2014-12-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (0-298)
      • engineered mutation (262)
    Domains in SCOPe 2.08: d4qaha_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4qahA (A:)
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqkadqlrfsylaviegakfimgdssvqdqwkelshedl