PDB entry 4qaf

View 4qaf on RCSB PDB site
Description: Crystal structure of an engineered lipocalin (Anticalin) in complex with VEGF(8-109)
Class: transport protein/signaling protein
Keywords: beta-barrel, binding protein, engineered lipocalin, TRANSPORT PROTEIN-SIGNALING PROTEIN complex
Deposited on 2014-05-04, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipocalin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: engineered variant, LCN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31025
      • engineered mutation (21-29)
      • engineered mutation (32)
      • engineered mutation (34)
      • engineered mutation (51)
      • engineered mutation (53)
      • engineered mutation (56)
      • engineered mutation (64)
      • engineered mutation (71)
      • engineered mutation (75)
      • engineered mutation (78)
      • engineered mutation (82)
      • engineered mutation (84)
      • engineered mutation (96)
      • engineered mutation (99)
      • engineered mutation (101)
      • engineered mutation (103)
      • engineered mutation (106)
      • engineered mutation (109)
  • Chain 'B':
    Compound: Lipocalin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: engineered variant, LCN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31025
      • engineered mutation (21-29)
      • engineered mutation (32)
      • engineered mutation (34)
      • engineered mutation (64)
      • engineered mutation (71)
      • engineered mutation (75)
      • engineered mutation (78)
      • engineered mutation (82)
      • engineered mutation (84)
      • engineered mutation (96)
      • engineered mutation (99)
      • engineered mutation (101)
      • engineered mutation (103)
      • engineered mutation (106)
      • engineered mutation (109)
  • Chain 'C':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Gene: VEGFA, VEGF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qafc_
  • Chain 'D':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Gene: VEGFA, VEGF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qafd_
  • Heterogens: OMA, SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qafC (C:)
    gqnhhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndegle
    cvpteesnitmqimrikphqgqhigemsflqhnkcecrpkkdsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qafC (C:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4qafD (D:)
    gqnhhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndegle
    cvpteesnitmqimrikphqgqhigemsflqhnkcecrpkkdsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qafD (D:)
    hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
    eesnitmqimrikphqgqhigemsflqhnkcecrp