PDB entry 4q7j

View 4q7j on RCSB PDB site
Description: Complex structure of viral RNA polymerase
Class: translation/transferase
Keywords: RNA polymerase, RNA binding motif, RNA dependent RNA polymerization, TRANSLATION-TRANSFERASE complex
Deposited on 2014-04-25, released 2014-08-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.258
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor ts
    Species: Escherichia coli [TaxId:83333]
    Gene: TSF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4q7ja1, d4q7ja2, d4q7ja3
  • Chain 'B':
    Compound: Elongation factor Tu 1
    Species: Escherichia coli [TaxId:83333]
    Gene: TUFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4q7jb1, d4q7jb2, d4q7jb3
  • Chain 'C':
    Compound: Q beta replicase
    Species: Enterobacteria phage Qbeta [TaxId:39803]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 30S ribosomal protein S1
    Species: Escherichia coli [TaxId:83333]
    Gene: rpsA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: elongation factor ts
    Species: Escherichia coli [TaxId:83333]
    Gene: TSF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4q7je1, d4q7je2, d4q7je3
  • Chain 'F':
    Compound: Elongation factor Tu 1
    Species: Escherichia coli [TaxId:83333]
    Gene: TUFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4q7jf1, d4q7jf2, d4q7jf3
  • Chain 'G':
    Compound: Q beta replicase
    Species: Enterobacteria phage Qbeta [TaxId:39803]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 30S ribosomal protein S1
    Species: Escherichia coli [TaxId:83333]
    Gene: rpsA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q7jA (A:)
    aeitaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgv
    iktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeerva
    lvakigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefi
    kpedvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepskt
    vgqllkehnaevtgfirfevgegiekvetdfaaevaamskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q7jA (A:)
    taslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgvikt
    kidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeervalva
    kigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpe
    dvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgq
    llkehnaevtgfirfevgegiekvetdfaaevaamskq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q7jB (B:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q7jB (B:)
    tkphvnvgtighvdhgkttltaaittvlaktygshveydtptrhyahvdcpghadyvknm
    itgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelvem
    evrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeperaidkpfl
    lpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrklldegrag
    envgvllrgikreeiergqvlakpgtikphtkfesevyilskdeggrhtpffkgyrpqfy
    frttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfaireggrtvgagvvakv
    lg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4q7jE (E:)
    aeitaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgv
    iktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeerva
    lvakigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefi
    kpedvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepskt
    vgqllkehnaevtgfirfevgegiekvetdfaaevaamskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q7jE (E:)
    itaslvkelrertgagmmdckkalteangdielaienmrksgaikaakkagnvaadgvik
    tkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqfeeervalv
    akigeninirrvaalegdvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikp
    edvsaevvekeyqvqldiamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvg
    qllkehnaevtgfirfevgegiekvetdfaaevaamskqs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4q7jF (F:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q7jF (F:)
    rtkphvnvgtighvdhgkttltaaittvlaktygtshveydtptrhyahvdcpghadyvk
    nmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelv
    emevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeperaidkp
    fllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrklldegr
    agenvgvllrgikreeiergqvlakpgtikphtkfesevyilskdeggrhtpffkgyrpq
    fyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfaireggrtvgagvva
    kvlg
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.