PDB entry 4q7e

View 4q7e on RCSB PDB site
Description: Non-phosphorylated HemR Receiver Domain from Leptospira biflexa
Class: signaling protein
Keywords: Response Regulator, DNA BINDING PROTEIN, SIGNALING PROTEIN
Deposited on 2014-04-24, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.141
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator of a two component regulatory system
    Species: Leptospira biflexa serovar Patoc [TaxId:355278]
    Gene: LBF_1368
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q7ea_
  • Chain 'B':
    Compound: Response regulator of a two component regulatory system
    Species: Leptospira biflexa serovar Patoc [TaxId:355278]
    Gene: LBF_1368
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q7eb_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q7eA (A:)
    gsgsmkprillveddeglgetlkerleqdkyrvewaktiseaenlyrpnafdlvvldlrl
    pdgngfdlaemivkkekdlpflfltaqagaqerlrgfelgaaefipkpfhlkeflirler
    visltrphy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q7eA (A:)
    mkprillveddeglgetlkerleqdkyrvewaktiseaenlyrpnafdlvvldlrlpdgn
    gfdlaemivkkekdlpflfltaqagaqerlrgfelgaaefipkpfhlkeflirlervisl
    trphy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q7eB (B:)
    gsgsmkprillveddeglgetlkerleqdkyrvewaktiseaenlyrpnafdlvvldlrl
    pdgngfdlaemivkkekdlpflfltaqagaqerlrgfelgaaefipkpfhlkeflirler
    visltrphy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q7eB (B:)
    kprillveddeglgetlkerleqdkyrvewaktiseaenlyrpnafdlvvldlrlpdgng
    fdlaemivkkekdlpflfltaqagaqerlrgfelgaaefipkpfhlkeflirlervislt
    rphy