PDB entry 4q6f

View 4q6f on RCSB PDB site
Description: Crystal structure of human BAZ2A PHD zinc finger in complex with unmodified H3K4 histone peptide
Class: Transcription
Keywords: Bromodomain adjacent to zinc finger domain protein 2A, Transcription termination factor I-interacting protein 5,TTF-I-interacting protein 5, Structural Genomics Consortium, SGC, Transcription
Deposited on 2014-04-22, released 2014-05-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4q6fa_
  • Chain 'B':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4q6fb_
  • Chain 'C':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4q6fc_
  • Chain 'D':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4q6fd_
  • Chain 'F':
    Compound: unmodified H3K4 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4Q6F (0-4)
  • Chain 'G':
    Compound: unmodified H3K4 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4Q6F (0-4)
  • Chain 'H':
    Compound: unmodified H3K4 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4Q6F (0-End)
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q6fA (A:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q6fA (A:)
    svnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q6fB (B:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q6fB (B:)
    nkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4q6fC (C:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q6fC (C:)
    kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4q6fD (D:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q6fD (D:)
    kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.