PDB entry 4q6f
View 4q6f on RCSB PDB site
Description: Crystal structure of human BAZ2A PHD zinc finger in complex with unmodified H3K4 histone peptide
Class: Transcription
Keywords: Bromodomain adjacent to zinc finger domain protein 2A, Transcription termination factor I-interacting protein 5,TTF-I-interacting protein 5, Structural Genomics Consortium, SGC, Transcription
Deposited on
2014-04-22, released
2014-05-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2015-04-22, with a file datestamp of
2015-04-17.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain adjacent to zinc finger domain protein 2A
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2A, KIAA0314, TIP5
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4q6fa_ - Chain 'B':
Compound: Bromodomain adjacent to zinc finger domain protein 2A
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2A, KIAA0314, TIP5
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4q6fb_ - Chain 'C':
Compound: Bromodomain adjacent to zinc finger domain protein 2A
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2A, KIAA0314, TIP5
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4q6fc_ - Chain 'D':
Compound: Bromodomain adjacent to zinc finger domain protein 2A
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2A, KIAA0314, TIP5
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4q6fd_ - Chain 'F':
Compound: unmodified H3K4 peptide
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: unmodified H3K4 peptide
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: unmodified H3K4 peptide
Database cross-references and differences (RAF-indexed):
- Heterogens: ZN, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4q6fA (A:)
hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
Sequence, based on observed residues (ATOM records): (download)
>4q6fA (A:)
svnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4q6fB (B:)
hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
Sequence, based on observed residues (ATOM records): (download)
>4q6fB (B:)
nkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
- Chain 'C':
Sequence, based on SEQRES records: (download)
>4q6fC (C:)
hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
Sequence, based on observed residues (ATOM records): (download)
>4q6fC (C:)
kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaq
- Chain 'D':
Sequence, based on SEQRES records: (download)
>4q6fD (D:)
hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
Sequence, based on observed residues (ATOM records): (download)
>4q6fD (D:)
kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.