PDB entry 4q59

View 4q59 on RCSB PDB site
Description: Crystal structure of plectin 1a actin-binding domain
Class: structural protein
Keywords: calponin homology domain, STRUCTURAL PROTEIN
Deposited on 2014-04-16, released 2014-07-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4q59a1, d4q59a2
  • Chain 'B':
    Compound: Plectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4q59b1, d4q59b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4q59A (A:)
    derdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslprekgrmrf
    hklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvsgqsed
    mtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrqtnle
    nldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4q59B (B:)
    derdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslprekgrmrf
    hklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvsgqsed
    mtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrqtnle
    nldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp