PDB entry 4q4l

View 4q4l on RCSB PDB site
Description: Crystal structure of an ATP synthase subunit beta 1 (F1-B1) from Burkholderia thailandensis
Class: hydrolase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, ATP-binding, metal ion binding, heterooligomeric protein complex, multidomain protein, HYDROLASE
Deposited on 2014-04-14, released 2014-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase subunit beta 1
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: aptD1, atpD1, BTH_I3308
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q4la1, d4q4la2, d4q4la3
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q4lA (A:)
    mahhhhhhmgtleaqtqgpgsmstaalvegkivqcigavidvefpresmpkiydalileg
    seltlevqqqlgdgvvrticlgasdglrrgvvvkntgnpisvpvgkptlgrimdvlgrpi
    deagpiesenkrsihqkapafdelspstelletgikvidlicpfakggkvglfggagvgk
    tvnmmelinniakehggysvfagvgertregndfyhemkdsnvldkvalvygqmneppgn
    rlrvaltgltmaehfrdegldvlffvdniyrftlagtevsallgrmpsavgyqptlaeem
    gklqeritstkkgsitsvqavyvpaddltdpspattfghldatvvlsrdiaslgiypavd
    pldstsrqidpnvigeehysitrrvqqtlqrykelrdiiailgmdelspedklsvarark
    iqrflsqpfhvaevftgspgkyvplketirgfkmivdgecdhlpeqafymvgtideafek
    akkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q4lA (A:)
    alvegkivqcigavidvefpresmpkiydalilegseltlevqqqlgdgvvrticlgalr
    rgvvvkntgnpisvpvgkptlgrimdvlgrpideagpiesenkrsihqkapafdelspst
    elletgikvidlicpfakggkvglfggagvgktvnmmelinniakehggysvfagvndfy
    hemkdsnvldkvalvygqmneppgnrlrvaltgltmaehfrdegldvlffvdniyrftla
    gtevsallgrmpsavgyqptlaeemgklqeritstkkgsitsvqavyvpahldatvvlsr
    diaslgiypavdpldstsrqidpnvigeehysitrrvqqtlqrykelrdiiailgmdels
    pedklsvararkiqrflsqpfhvaevftgspgkyvplketirgfkmivdgecdhlpeqaf
    ymvgtideafekakki