PDB entry 4q48

View 4q48 on RCSB PDB site
Description: Structure of the RecQ Catalytic Core from Deinococcus radiodurans
Class: DNA binding protein
Keywords: DNA unwinding, helicase, DNA BINDING PROTEIN
Deposited on 2014-04-14, released 2015-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA helicase RecQ
    Species: Deinococcus radiodurans [TaxId:243230]
    Gene: DR_1289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q48a1, d4q48a2, d4q48a3
  • Chain 'B':
    Compound: DNA helicase RecQ
    Species: Deinococcus radiodurans [TaxId:243230]
    Gene: DR_1289
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q48b1, d4q48b2, d4q48b3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q48A (A:)
    mtaapaalhdralhllqtiwgypafrgvqgeivqqvaeggnalvlmptgggkslcyqlps
    llrpgtgivvsplialmkdqvdtlrqngvraaflnstllphearevedallrgdldllyv
    aperllmprtldllerapvalfaideahcvsqwghdfrpeyqqlsvlaerfpelprvalt
    atadertradiksvlrledapqfvssfdrpniqyrvglkdspktqllhfireehpgdagi
    vyclsrksveetakwlqaqgidalayhaglssternnvqerflneegvivcatvafgmgi
    dkpnvrfvahldlpksmegyyqetgragrdglpstawmvyglsdvvnvrrmlaqsdapee
    vkrveaskldalltyceaatcrrqvllhyfgeelsepcgncdvclnpprvrdltreaqma
    lsatirtgnrfgaahltdvllgretdkvlaqghhqlptfgvgkehdeklwrsvlrqlvsl
    gylsaddhfglratgksrgilkegqklllredtllpglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q48A (A:)
    lhdralhllqtiwgypafrgvqgeivqqvaeggnalvlmptgggkslcyqlpsllrpgtg
    ivvsplialmkdqvdtlrqngvraaflnstllphearevedallrgdldllyvaperllm
    prtldllerapvalfaideahcvsqwghdfrpeyqqlsvlaerfpelprvaltatadert
    radiksvlrledapqfvssfdrpniqyrvglkdspktqllhfireehpgdagivyclsrk
    sveetakwlqaqgidalayhaglssternnvqerflneegvivcatvadkpnvrfvahld
    lpksmegyyqetgragrdglpstawmvyglsdvvnvrrmlaqsdapeevkrveaskldal
    ltyceaatcrrqvllhyfgeelsepcgncdvclnpprvrdltreaqmalsatirtgnrfg
    aahltdvllgretdkvlaqghhqlptfgvgkehdeklwrsvlrqlvslgylsaddhfglr
    atgksrgilkegqklllred
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q48B (B:)
    mtaapaalhdralhllqtiwgypafrgvqgeivqqvaeggnalvlmptgggkslcyqlps
    llrpgtgivvsplialmkdqvdtlrqngvraaflnstllphearevedallrgdldllyv
    aperllmprtldllerapvalfaideahcvsqwghdfrpeyqqlsvlaerfpelprvalt
    atadertradiksvlrledapqfvssfdrpniqyrvglkdspktqllhfireehpgdagi
    vyclsrksveetakwlqaqgidalayhaglssternnvqerflneegvivcatvafgmgi
    dkpnvrfvahldlpksmegyyqetgragrdglpstawmvyglsdvvnvrrmlaqsdapee
    vkrveaskldalltyceaatcrrqvllhyfgeelsepcgncdvclnpprvrdltreaqma
    lsatirtgnrfgaahltdvllgretdkvlaqghhqlptfgvgkehdeklwrsvlrqlvsl
    gylsaddhfglratgksrgilkegqklllredtllpglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q48B (B:)
    lhdralhllqtiwgypafrgvqgeivqqvaeggnalvlmptgggkslcyqlpsllrpgtg
    ivvsplialmkdqvdtlrqngvraaflnstllphearevedallrgdldllyvaperllm
    prtldllerapvalfaideahcvsqwghdfrpeyqqlsvlaerfpelprvaltatadert
    radiksvlrledapqfvssfdrpniqyrvglkdspktqllhfireehpgdagivyclsrk
    sveetakwlqaqgidalayhaglssternnvqerflneegvivcatvadkpnvrfvahld
    lpksmegyyqetgragrdglpstawmvyglsdvvnvrrmlaqsdapeevkrveaskldal
    ltyceaatcrrqvllhyfgeelsepcgncdvclnpprvrdltreaqmalsatirtgnrfg
    aahltdvllgretdkvlaqghhqlptfgvgkehdeklwrsvlrqlvslgylsaddhfglr
    atgksrgilkegqklllredt